PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02326.1.g00040.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 328aa    MW: 35389.8 Da    PI: 9.4172
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02326.1.g00040.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.7e-19182236256
                                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                     rk+ +++k+q  +Lee F+++++++ ++++ LAk+l+L+ rqV vWFqNrRa+ k
  Zpz_sc02326.1.g00040.1.sm.mkhc 182 RKKLRLSKDQAAVLEESFKEHNTLNPKQKAALAKQLNLKPRQVEVWFQNRRARTK 236
                                     788899***********************************************98 PP

2HD-ZIP_I/II125.62.3e-40182271191
                     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeener 79 
                                     +kk+rlsk+q+++LEesF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+k++E+d+e Lkr++++l+een+r
  Zpz_sc02326.1.g00040.1.sm.mkhc 182 RKKLRLSKDQAAVLEESFKEHNTLNPKQKAALAKQLNLKPRQVEVWFQNRRARTKLKKTEVDCELLKRCCESLTEENRR 260
                                     69***************************************************************************** PP

                     HD-ZIP_I/II  80 LekeveeLreel 91 
                                     L++ev+eLr +l
  Zpz_sc02326.1.g00040.1.sm.mkhc 261 LQREVAELR-AL 271
                                     ********9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046188.7E-2417148IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.602.2E-19166232IPR009057Homeodomain-like
SuperFamilySSF466891.04E-18169239IPR009057Homeodomain-like
PROSITE profilePS5007117.281178238IPR001356Homeobox domain
SMARTSM003895.4E-17180242IPR001356Homeobox domain
CDDcd000861.32E-17182239No hitNo description
PfamPF000467.5E-17182236IPR001356Homeobox domain
PROSITE patternPS000270213236IPR017970Homeobox, conserved site
SMARTSM003401.1E-20238281IPR003106Leucine zipper, homeobox-associated
PfamPF021832.6E-9238272IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MMVNTSRGDE QYGGRHDHSL GLSLSLGIAT AAAPVEPTPP EQHQQKRAPI SPHFALQQPQ  60
QCWNGFSNGF FFSPFSGTDR SLFERKQQPQ QPAAAACRGH EMPFLRGIDV NRAPGGEVSR  120
RGSCSEDEEP GASSPNSTLS SLSGKRGAAA TTSGGGEGDL MPRAAGGGSD DEDSGAGGGG  180
SRKKLRLSKD QAAVLEESFK EHNTLNPKQK AALAKQLNLK PRQVEVWFQN RRARTKLKKT  240
EVDCELLKRC CESLTEENRR LQREVAELRA LKLIAAPHPY ARIPPPPTTL TMCPSCERVA  300
DAARTAPAGP WGPVPVRPVF VDGPARRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1180186SRKKLRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983649.11e-137PREDICTED: homeobox-leucine zipper protein HOX1 isoform X2
SwissprotQ406914e-83HOX1_ORYSI; Homeobox-leucine zipper protein HOX1
SwissprotQ7XC544e-83HOX1_ORYSJ; Homeobox-leucine zipper protein HOX1
TrEMBLA0A0A9D6C91e-137A0A0A9D6C9_ARUDO; Uncharacterized protein
STRINGSi036388m1e-134(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.18e-57homeobox from Arabidopsis thaliana